DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83b and Obp57c

DIOPT Version :10

Sequence 1:NP_524242.2 Gene:Obp83b / 40738 FlyBaseID:FBgn0010403 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster


Alignment Length:108 Identity:25/108 - (23%)
Similarity:51/108 - (47%) Gaps:14/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CAPKTGVTDEAIKEFSDGQIHEDEAL-------KCYMNCLFHEFEVVDDNGDVHMEKVLNAIP-G 97
            |.....::....:|..|....|::.|       ||:::||..:..::|.||.:.::|:....| .
  Fly    32 CLASNNISQAEFQELIDRNSSEEDDLENTDRRYKCFIHCLAEKGNLLDTNGYLDVDKIDQIEPVS 96

  Fly    98 EKLRNIMMEASKGCIHPEGDTLCHKAWWFHQC----WKKADPV 136
            ::||.|:.:..|  |:.|.:..|..|:....|    ::::|.|
  Fly    97 DELREILYDCKK--IYDEEEDHCEYAFKMVTCLTESFEQSDEV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83bNP_524242.2 PBP_GOBP 28..133 CDD:460193 23/103 (22%)
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 23/100 (23%)

Return to query results.
Submit another query.