DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83b and Obp56a

DIOPT Version :10

Sequence 1:NP_524242.2 Gene:Obp83b / 40738 FlyBaseID:FBgn0010403 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster


Alignment Length:111 Identity:29/111 - (26%)
Similarity:49/111 - (44%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LGKHFHDICAPKTGVTDEA-----IKEFSDGQIHEDEALKCYMNCLFHEFEVVDD---NGDVHME 89
            |.|...:.||.:..:|:|.     .|:|:    :..|.:||:.||.|.:...:.|   ...|.:|
  Fly    31 LAKQHREQCAEEVKLTEEEKAKVNAKDFN----NPTENIKCFANCFFEKVGTLKDGELQESVVLE 91

  Fly    90 KVLNAIPGEKLRNIMMEASKGCIHPEGDTLCHKAWWFHQCWKKADP 135
            | |.|:.||:.....:|.   |...:|:..|..|...:.|::...|
  Fly    92 K-LGALIGEEKTKAALEK---CRTIKGENKCDTASKLYDCFESFKP 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83bNP_524242.2 PBP_GOBP 28..133 CDD:460193 28/107 (26%)
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:460193 27/104 (26%)

Return to query results.
Submit another query.