DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83b and Obp57e

DIOPT Version :10

Sequence 1:NP_524242.2 Gene:Obp83b / 40738 FlyBaseID:FBgn0010403 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_611488.1 Gene:Obp57e / 326110 FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster


Alignment Length:101 Identity:24/101 - (23%)
Similarity:44/101 - (43%) Gaps:25/101 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VTDEAIKEFSDGQIHE-------DEALKCYMNCLFHEFEVVDDNGDVHMEKVLN---------AI 95
            |:...:.|:...|:.|       |.|.||::.|:..:..::|:.|:|.::|.:.         ||
  Fly    29 VSQNELSEYEAHQVMENWPVPPIDRAYKCFLTCVLLDLGLIDERGNVQIDKYMKSGVVDWQWVAI 93

  Fly    96 PGEKLRNIMMEASKGCIHPEGDTLCHKAWWFHQCWK 131
               :|....:|.|     .|.| ||..::....|:|
  Fly    94 ---ELVTCRIEFS-----DERD-LCELSYGIFNCFK 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83bNP_524242.2 PBP_GOBP 28..133 CDD:460193 24/101 (24%)
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 24/101 (24%)

Return to query results.
Submit another query.