DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83b and Obp56i

DIOPT Version :10

Sequence 1:NP_524242.2 Gene:Obp83b / 40738 FlyBaseID:FBgn0010403 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster


Alignment Length:119 Identity:30/119 - (25%)
Similarity:46/119 - (38%) Gaps:27/119 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PPAILKLGKHFHDICAPKTGVT--DEAIKEFSDGQIHEDEALKCYMNCLFHEFEVVDDNGDVHME 89
            |...::.|. ..|.|....|:|  |.|.:..:|...|   ::||:..|......::.||      
  Fly    17 PTCFVQAGP-IKDQCMAAAGITAQDVANRHETDDPGH---SVKCFFRCFLENIGIIADN------ 71

  Fly    90 KVLNAIPG---EKLRNIM-------MEASKGCIHPE--GDTLCHKAWWFHQCWK 131
               ..|||   ..|.:|:       |||:...|..|  .|..|..||...:|::
  Fly    72 ---QIIPGAFDRVLGHIVTAEAVERMEATCNMIKSETSHDESCEFAWQISECYE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83bNP_524242.2 PBP_GOBP 28..133 CDD:460193 29/118 (25%)
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:460193 27/108 (25%)

Return to query results.
Submit another query.