DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83a and Obp83ef

DIOPT Version :9

Sequence 1:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster


Alignment Length:112 Identity:20/112 - (17%)
Similarity:41/112 - (36%) Gaps:33/112 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CVEKTGVTEAAIKEFSDGEIHEDEKLKCYMNCFFHEIEVVDDNGDVHLEKL-------------- 125
            |..:...|...:.::|  ::...|.:.|...||...:...|.:|:..||..              
  Fly   137 CSRQLNATNVELLQYS--KLKSKEPIPCLFQCFADAMGFYDPDGNWRLENWKQAFGPSGNEDQSS 199

  Fly   126 ---FATVPLSMRDKLMEMSKGCVHPEGDTLCHKAWWFHQ--CWKKAD 167
               ::...||...:.:.:||          |  :|.:|:  ||::.:
  Fly   200 GADYSGCRLSGTQREVALSK----------C--SWMYHEYKCWERVN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 20/109 (18%)
Obp83efNP_731042.1 PhBP 28..124 CDD:214783
PhBP 133..234 CDD:214783 20/110 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.