DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83a and Obp69a

DIOPT Version :9

Sequence 1:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster


Alignment Length:103 Identity:24/103 - (23%)
Similarity:46/103 - (44%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PGILKMAKPFHDACVEKTGVTEAAI-KEFSDGEIHEDEKLKCYMNCFFHEIEVVDDNGDVHLEKL 125
            |.|:|..:.....|:.:||.:...| |...:..:..|.::||::.|.|....::|....:|||.|
  Fly    29 PTIIKQVRKLRMRCLNQTGASVDVIDKSVKNRILPTDPEIKCFLYCMFDMFGLIDSQNIMHLEAL 93

  Fly   126 FATVPLSMRDKLMEMSKGCVHPEGDTLCHKAWWFHQCW 163
            ...:|..:...:..:...|...:|...|..|:...:|:
  Fly    94 LEVLPEEIHKTINGLVSSCGTQKGKDGCDTAYETVKCY 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 23/101 (23%)
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 24/103 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DZXH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.