DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83a and Obp57c

DIOPT Version :9

Sequence 1:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster


Alignment Length:97 Identity:23/97 - (23%)
Similarity:46/97 - (47%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CVEKTGVTEAAIKEFSDGEIHE-------DEKLKCYMNCFFHEIEVVDDNGDVHLEKLFATVPLS 132
            |:....:::|..:|..|....|       |.:.||:::|...:..::|.||.:.::|:....|:|
  Fly    32 CLASNNISQAEFQELIDRNSSEEDDLENTDRRYKCFIHCLAEKGNLLDTNGYLDVDKIDQIEPVS 96

  Fly   133 MRDKLMEMSKGC--VHPEGDTLCHKAWWFHQC 162
              |:|.|:...|  ::.|.:..|..|:....|
  Fly    97 --DELREILYDCKKIYDEEEDHCEYAFKMVTC 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 23/97 (24%)
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 23/97 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.