DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83a and Obp56g

DIOPT Version :9

Sequence 1:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_995903.1 Gene:Obp56g / 37270 FlyBaseID:FBgn0034474 Length:132 Species:Drosophila melanogaster


Alignment Length:142 Identity:32/142 - (22%)
Similarity:57/142 - (40%) Gaps:27/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ALSLLSGALILPPAAAQRDENYPPPGIL--------KMAKPFHDACVEKTGVTEAAIKEFSDGEI 94
            ||:||.|.|               .|||        .::|.....|:::.|||...:.:...|::
  Fly     6 ALTLLLGCL---------------SGILAQQANIDSSVSKELVTDCLKENGVTPQDLADLQSGKV 55

  Fly    95 H-EDEK--LKCYMNCFFHEIEVVDDNGDVHLEKLFATVPLS-MRDKLMEMSKGCVHPEGDTLCHK 155
            . ||.|  :||...|...:...:|..|.:..:|:.:....| .:|.:.:....|...:|...|..
  Fly    56 KAEDAKDNVKCSSQCILVKSGFMDSTGKLLTDKIKSYYANSNFKDVIEKDLDRCSAVKGANACDT 120

  Fly   156 AWWFHQCWKKAD 167
            |:....|::.|:
  Fly   121 AFKILSCFQAAN 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 24/113 (21%)
Obp56gNP_995903.1 PBP_GOBP 30..131 CDD:279703 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.