DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83a and Obp56e

DIOPT Version :9

Sequence 1:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster


Alignment Length:130 Identity:35/130 - (26%)
Similarity:58/130 - (44%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LIALSLLSGALILPPAAAQRDENYPPPGILKMAKPFHDACVEKTGVT-EAAIKEFSDGEIHEDEK 99
            |.||||.|...:.....|:             ||....|||::.|:| |.||...|......|.|
  Fly    10 LAALSLASAVGLTDSQKAE-------------AKQRAKACVKQEGITKEQAIALRSGNFADSDPK 61

  Fly   100 LKCYMNCFFHEIEVVDDNGDVHLEKLFATV-PLSMRDKLMEMSKGCVHPEGDTLCHKAWWFHQCW 163
            :||:.|||..:..:| .||.:..:.:.|.: |::....:.|:...|...:|...|..::..::|:
  Fly    62 VKCFANCFLEQTGLV-ANGQIKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYKCY 125

  Fly   164  163
              Fly   126  125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 28/102 (27%)
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:279703 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.