DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83a and Obp56b

DIOPT Version :9

Sequence 1:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster


Alignment Length:137 Identity:30/137 - (21%)
Similarity:62/137 - (45%) Gaps:26/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LLIALSLLSGALILPPAAAQRDENYPPPGILKMAKPFHDACVEKTGVTEA-AIKEFSDGEI-HED 97
            |:.|||    .|:...:||:          |...|....||:::..:..: |....:|.|: :..
  Fly    11 LIFALS----ELVAGQSAAE----------LAAYKQIQQACIKELNIAASDANLLTTDKEVANPS 61

  Fly    98 EKLKCYMNCFFHEIEVVDDNGDVHLEKL-------FATVPLSMRDKLMEMSKGCVHPEGDTLCHK 155
            |.:|||.:|.:.::.::.|:|..:.:|:       |:::|:   |||..:...|...:....|..
  Fly    62 ESVKCYHSCVYKKLGLLGDDGKPNTDKIVKLAQIRFSSLPV---DKLKSLLTSCGTTKSAATCDF 123

  Fly   156 AWWFHQC 162
            .:.:.:|
  Fly   124 VYNYEKC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 23/108 (21%)
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.