DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83a and Obp51a

DIOPT Version :9

Sequence 1:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_725436.1 Gene:Obp51a / 246666 FlyBaseID:FBgn0043530 Length:117 Species:Drosophila melanogaster


Alignment Length:141 Identity:30/141 - (21%)
Similarity:50/141 - (35%) Gaps:44/141 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VLLIALSLLSGALILPPAAAQRDENYPPPGILKMAKPFHDACVEKTGVTEAAIKEFSDGEIHEDE 98
            |||:|::.||.||....|                     :.|.:|.|:|....:.|.     ...
  Fly     8 VLLLAVTTLSSALFESEA---------------------NECAKKLGITPDYFENFP-----HSS 46

  Fly    99 KLKCYMNCFFHEIEVVDDNGDVHLEKLFATVPLSMR---------DKLMEMSKGCVHPEGDTLCH 154
            ::||:.:|...::|:: .||.|        .|..::         ||.....|.|:.......|.
  Fly    47 RVKCFYHCQMEKLEII-ANGVV--------TPFDLKVLNISPESYDKYGVKVKPCLKLSHRDKCE 102

  Fly   155 KAWWFHQCWKK 165
            ..:...||.|:
  Fly   103 LGYLVFQCLKR 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 21/111 (19%)
Obp51aNP_725436.1 PBP_GOBP 25..114 CDD:279703 22/124 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.