DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83a and Obp83g

DIOPT Version :9

Sequence 1:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster


Alignment Length:142 Identity:30/142 - (21%)
Similarity:53/142 - (37%) Gaps:20/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SASVLLIALSLLSGALILPPAAAQRDENYPPPGILK----MAKPFHDACVEKTGVTEAAIKEFSD 91
            |.|:|||.      |.:.....||....:    :||    ..|.|.: |.|...|.:...:::.:
  Fly     3 SQSLLLIV------AAVATFLVAQTTAKF----LLKDHADAEKAFEE-CREDYYVPDDIYEKYLN 56

  Fly    92 GEIHEDEKLKCYMNCFFHEIEVVDDNGDVHLEKLFATVPLSMRDKLMEMSKG---CV-HPEGDT- 151
            .|.....:..|::.||..::|:..:........:.|.........|..:..|   |: |.|.:: 
  Fly    57 YEFPAHRRTSCFVKCFLEKLELFSEKKGFDERAMIAQFTSKSSKDLSTVQHGLEKCIDHNEAESD 121

  Fly   152 LCHKAWWFHQCW 163
            :|..|.....||
  Fly   122 VCTWANRVFSCW 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 22/109 (20%)
Obp83gNP_731043.1 PBP_GOBP 22..134 CDD:279703 22/117 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.