DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83a and OBP28

DIOPT Version :9

Sequence 1:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_320222.2 Gene:OBP28 / 1280375 VectorBaseID:AGAP012325 Length:134 Species:Anopheles gambiae


Alignment Length:134 Identity:29/134 - (21%)
Similarity:60/134 - (44%) Gaps:13/134 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LSLLSGALILPPAAAQR---DENYPPPGILKMAKPFHDACVEK-TGVTEAAIKEFSDGEIHE-DE 98
            :.||...::|...||.:   |:.      :|.|:.|...|:|: .|:.:..:....||:..: |.
Mosquito     1 MKLLFATVLLAVCAAAQPLTDDQ------MKKAEGFALGCLEQHKGLNKEHLVLLRDGDFSKVDA 59

  Fly    99 KLKCYMNCFFHEIEVVDDNGDVHLEKLFATVPLSM-RDKLMEMSKGC-VHPEGDTLCHKAWWFHQ 161
            ..||::.||..:...:|..|.:..:.:...:.|:. :.|:..:.|.| ...|.:..|..|:...:
Mosquito    60 DTKCFLRCFLQQANFMDAAGKLQNDYVIERLSLNREKSKVEALVKKCSAGVEVEDSCETAFRAVE 124

  Fly   162 CWKK 165
            |:.:
Mosquito   125 CYHR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 23/106 (22%)
OBP28XP_320222.2 PBP_GOBP 16..129 CDD:279703 24/119 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.