DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2017 and eIF2gamma

DIOPT Version :9

Sequence 1:NP_649603.3 Gene:CG2017 / 40733 FlyBaseID:FBgn0037391 Length:643 Species:Drosophila melanogaster
Sequence 2:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster


Alignment Length:374 Identity:78/374 - (20%)
Similarity:130/374 - (34%) Gaps:120/374 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 EIGVSDAGYLQGLSDKDMNASLTTLKQMAHSLGASTSVLRRKTIAARRAVAEVLVRKIPDDQHNI 214
            :|||:.....|.||:.|: :.||.|         |..|:.|:.                      
  Fly     7 QIGVNRNLQKQDLSNLDV-SKLTPL---------SPEVISRQA---------------------- 39

  Fly   215 EVRVAVLGGADAGKSTLL----GVLTQDELDNGHGRARLNMFRHMHEIQSGRTSCISHETLGFDA 275
            .:.:..:|....||||::    ||.|               .|..:|::...|.     .||:  
  Fly    40 TINIGTIGHVAHGKSTVVKAISGVQT---------------VRFKNELERNITI-----KLGY-- 82

  Fly   276 LGNVVNYKYNE---MMTAEEISDRSSK-------------------LVTFMDLAGHRRYMRTTVQ 318
             .|...||.:.   ...|..:||.|||                   .|:|:|..||...|.|.:.
  Fly    83 -ANAKIYKCDNPKCPRPASFVSDASSKDDSLPCTRLNCSGNFRLVRHVSFVDCPGHDILMATMLN 146

  Fly   319 ALSGYSPHYAMLVVSAGSGC-NDTTEEHLAIVRALDM-PFFVLVTKTDI---TSPDATVQELCNL 378
            ..:....  |:|:::....| ...|.||||.:..:.: ...:|..|.|:   :......:|:...
  Fly   147 GAAVMDA--ALLLIAGNESCPQPQTSEHLAAIEIMKLKQILILQNKIDLIKESQAKEQYEEITKF 209

  Fly   379 LTTIGCRKVPFVVTNTDEAISAGSNQISENIVPIFC--VSN---VTGTGLNLVTKFLYVLSPGIS 438
            :........|.:      .|||   |:..|| .:.|  :.|   |.....|...:.:.:.|..::
  Fly   210 VQGTVAEGAPII------PISA---QLKYNI-DVLCEYIVNKIPVPPRDFNAPPRLIVIRSFDVN 264

  Fly   439 NAEKDRLEQESCEFQVDEIFRVSDV-GPVVGGLLVQGVLTENMAMKIGP 486
                    :..||        |:|: |.|.||.::.|||.....:::.|
  Fly   265 --------KPGCE--------VADLKGGVAGGSILSGVLKVGQEIEVRP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2017NP_649603.3 GTPBP1 100..635 CDD:227583 78/374 (21%)
GTPBP1_like 217..436 CDD:206728 53/254 (21%)
GTPBP_II 450..536 CDD:293895 12/38 (32%)
GTPBP_III 547..634 CDD:294007
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 75/370 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.