DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1213 and SIT1

DIOPT Version :9

Sequence 1:NP_001246937.1 Gene:CG1213 / 40728 FlyBaseID:FBgn0037387 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_010849.3 Gene:SIT1 / 856644 SGDID:S000000791 Length:628 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:49/258 - (18%)
Similarity:99/258 - (38%) Gaps:74/258 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 GVHDEMAEIQANVEEAMASKGTVMDLFKNAGNRRALFICAGLISFQQLSGINVVLFNSQSIFASA 316
            |||:  .||.|             :::.....|.|||....||::..  |::..:..:...:|::
Yeast    53 GVHN--IEIYA-------------EMYNRPIYRVALFFSLFLIAYAY--GLDGNIRYTFQAYATS 100

  Fly   317 NTGLDPAIATIIIGCVQVGSSALTPL----VADRLGRKVMLLTS-----------SSVMSIGLAA 366
            :......::|  :.|::...:|:..:    ::|..||..:::.|           |..::|...|
Yeast   101 SYSQHSLLST--VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFA 163

  Fly   367 LGAFFYMQLVKGDISSVVWMPVPALIIYNIVYCTGFGPLPWAVLGEMFPA-----NI---KSVAS 423
            :|..||.            :.:..:|:...|..:.|..|.|.:|....||     |.   .:|.|
Yeast   164 VGGCFYQ------------LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTS 216

  Fly   424 SVVASTCWTLGFLVTFFYPSLDALGSYYAFWLFAVCMVVAFFFVLFVVMETKGLSLQQIQDRL 486
            ::.|:..|.:|.               :||.|...|:.:.     ..::..:.|:.:..:|||
Yeast   217 AIDANWKWGIGM---------------WAFILPLACIPLG-----ICMLHMRYLARKHAKDRL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1213NP_001246937.1 SP 42..482 CDD:273317 46/252 (18%)
MFS 47..460 CDD:119392 44/230 (19%)
SIT1NP_010849.3 MFS_ARN_like 70..582 CDD:340880 43/226 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.