DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1213 and CG17930

DIOPT Version :9

Sequence 1:NP_001246937.1 Gene:CG1213 / 40728 FlyBaseID:FBgn0037387 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_650533.1 Gene:CG17930 / 41979 FlyBaseID:FBgn0038416 Length:502 Species:Drosophila melanogaster


Alignment Length:525 Identity:111/525 - (21%)
Similarity:200/525 - (38%) Gaps:148/525 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EGNTRTMSPEPVKSGRIFMAAVAANLSAFVVGTT----LGWTSPIGPKLKSEDTSDSPLSRPITS 86
            :.|:|..:|...:||      .||.|.....|..    |||..             :.:|.....
  Fly    51 QSNSRWATPTQTQSG------TAATLLFVYAGMDMAQGLGWNL-------------TAVSANTLE 96

  Fly    87 DEDAWISSLIAVGALVAPFVAGPMADRIGRKWVLLSSSLFFVLAFGLNMVASEVWI--------L 143
            .:.:|...:| :||:|:...:           ..|...:|:.|...:|::.:.:::        :
  Fly    97 FQYSWFIGVI-IGAVVSAITS-----------AFLPKIVFYGLGGVMNLIDAIIFVSAPYEYESI 149

  Fly   144 YMSRLIQGFGVGFVMTVQPMYVGEISTDNVRGATGSLMQLFIVGGILYVYAIGPYVSYQAL---Q 205
            ..:|.:.|.|:|.:.....::..||::...||...:|.|        |..|:|  |:.|.:   |
  Fly   150 LAARYVGGVGIGLITVPFLIHSAEIASSTNRGTCCALEQ--------YGLALG--VAIQVIYDSQ 204

  Fly   206 WCCIV------VPVVFDLVFYMMP--------ESPYFFAGKGRKSEALKSLQFLRGQ-------- 248
            |...:      |..:|.:||..:.        :||.|:..:.::.:|..|::.|.|.        
  Fly   205 WSQGLGMTINRVHGIFGIVFTAIALGSVAITIDSPIFYIRQNQEQKARASVKQLMGSYWTREAGD 269

  Fly   249 -------------SAEGVHDEMAEIQANVEEAMASKGTVMDLFKNAGNRRALFICAGLISFQQLS 300
                         ||:||.:::.|             ::|...|     ..||.|....:|    
  Fly   270 RAYDEAKLYVVEGSAQGVGEQLGE-------------SMMPFLK-----LLLFRCFVAFTF---- 312

  Fly   301 GINVVLFNSQSIFASAN--TGLDPAIATIIIGCVQVGSSALTPLVADRLGRKVMLLTSSSVMSIG 363
              :|.|  |.||..:..  .|...:..|||.|.:::..:.:|..|.|.:|||.:.|       :|
  Fly   313 --SVPL--SYSILTTTELVEGTLHSWPTIIFGLLRLIGALITFAVLDTVGRKFVSL-------LG 366

  Fly   364 LAAL-GAFFYMQLVKGDISSV-----VW----MPVPALIIYNIVYCTGFGPLPWAVLGEMFPANI 418
            |..: |....|..|.||...:     :|    :.:..........|:..     |.|||.||..:
  Fly   367 LMCMAGLMLGMAGVYGDYGHIFDDYFMWQVCRLGMAFQFFAGFFICSSS-----AYLGEAFPMRV 426

  Fly   419 KSVASSVVASTCWTLGFLVTF-FYPSLDALGSYYAFWLFAVCMVVAFFFVLFVVM--ETKGLSLQ 480
            |.....::......:..:|.. |.|:.:   .||.::: ||.:::....|.|.|:  ||:||:|:
  Fly   427 KPFLIGLIVCLEQVIHIIVIVKFVPTAE---FYYTYFV-AVGIIMVIGLVAFAVLMPETRGLTLR 487

  Fly   481 QIQDR 485
            |..:|
  Fly   488 QAGER 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1213NP_001246937.1 SP 42..482 CDD:273317 104/504 (21%)
MFS 47..460 CDD:119392 96/475 (20%)
CG17930NP_650533.1 Sugar_tr 102..493 CDD:278511 97/455 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.