DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1213 and CG42825

DIOPT Version :9

Sequence 1:NP_001246937.1 Gene:CG1213 / 40728 FlyBaseID:FBgn0037387 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_729590.1 Gene:CG42825 / 39179 FlyBaseID:FBgn0262007 Length:518 Species:Drosophila melanogaster


Alignment Length:519 Identity:110/519 - (21%)
Similarity:196/519 - (37%) Gaps:118/519 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 REGNTRTMSPEPVKSGRIFM----------AAVAANLSAFVVGTTLGWTSPIGPKLKSEDTSDSP 79
            |:.:||...|     |..|.          |..||.|.....|..:.|.......:..:.|..:.
  Fly    55 RDPHTRVDPP-----GGCFQRNQKNKPQSNAVGAAGLIFISGGMNIAWAIGFQGPIYYQTTKHNY 114

  Fly    80 LSRPITSDEDAWISSLIAVGALVAPFVAGPMADRIGRKWVLLSSSLF-----FVLAFGLNMVASE 139
            :         ||.     :||::...|...:.:::.:|::|..||:.     .|:|...|..|..
  Fly   115 I---------AWF-----IGAIIGALVTMALTNKVAKKYILQFSSVLVTVGGLVIACTHNNGAGT 165

  Fly   140 VWILYMSRLIQGFGVGFVMTVQPMYVGEISTDNVRG-ATGSLMQLFIVGG----ILYV--YAIGP 197
            ....|    :.|...|.|.......|||||...:|| |:.:|.||....|    ||||  :....
  Fly   166 TAACY----LDGIANGLVFAPFMALVGEISVPYLRGKASATLEQLCFGTGILLQILYVSNWTYSS 226

  Fly   198 YVSY-----QALQWCCIVVPVVFDLVF--YMMPESPYFFAGKGRKSEALKSLQFLRGQSAEGVHD 255
            |::|     :.::.....:..|..|:.  :...|||........:..|:.:|:  |.|....:.:
  Fly   227 YMTYNDFTSENMKGVLSTIYGVLALIMGSFFTIESPVLMLANNEEQAAIDALR--RLQKPAVLTE 289

  Fly   256 EMAEIQANVEEAMASKGTVMDLFKNAGNRRALFICAGLISFQQLSGINVVLFNSQSIFASANTGL 320
            |..|:.|..:..:|..       ||.....:  |...|.:|.:|:.:..:  |:.||  |:...:
  Fly   290 ETYELLAEHKRYLAYN-------KNMSKSES--ISKALPTFMRLAYLRAL--NAMSI--SSFVII 341

  Fly   321 DPAIATII-----------IG---CVQVGSSALTP-LVADRLGRKVMLLTSSSVMSIGLA-ALGA 369
            ...:|.::           ||   |..:||  |.| ...:.||||...: ...::|.||: |:|:
  Fly   342 TYVVAILVSNDLRNASSWYIGLAFCRWLGS--LIPSFCMESLGRKKPAV-FGLLVSCGLSFAVGS 403

  Fly   370 FFYMQLVKGDISSVVWMPVPALIIYNIVYCTGFGPLPWAVLGEMFPANIK----------SVASS 424
            .:.:......::.::       :|:.......|.... |.|.|.:|..:|          .:...
  Fly   404 QYNVYTYMSQVTVLI-------MIFEFFAGMAFSSNS-AYLTEAYPMGVKQHFIGLTFITEIFVF 460

  Fly   425 VVASTC-WTLGFLVTFFYPSLDALGSYYAFWLFAVCMVVAFFFVLFVVMETKGLSLQQIQDRLN 487
            ::.:.| :..|....:||    .:|:.|   |..|.:.|      ..:.||:.::||..|::.|
  Fly   461 LIINVCDFNFGQGYNYFY----IMGAMY---LAGVILGV------LTLPETRRMTLQGAQEQFN 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1213NP_001246937.1 SP 42..482 CDD:273317 103/495 (21%)
MFS 47..460 CDD:119392 96/458 (21%)
CG42825NP_729590.1 MFS 116..490 CDD:119392 90/415 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.