DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1213 and srx-118

DIOPT Version :9

Sequence 1:NP_001246937.1 Gene:CG1213 / 40728 FlyBaseID:FBgn0037387 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_496675.2 Gene:srx-118 / 188681 WormBaseID:WBGene00006009 Length:328 Species:Caenorhabditis elegans


Alignment Length:284 Identity:52/284 - (18%)
Similarity:95/284 - (33%) Gaps:116/284 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QYSYTEVSTFQIREGNTRTMSPEPVKSGRIFMAAVAANLSAFVVGTT------------------ 59
            ::.|:|.||     .:|||:|...:    |.::.:.:.::..:...|                  
 Worm     7 EFLYSEFST-----PSTRTVSAVML----IVVSIIGSIMNVLIFIATFFRVTKRDGFLKICCFNS 62

  Fly    60 -------LGWTSPIGPKLKSEDTSDSPLSRPITSDEDAWISSLIAVGALVAPF--VAGPMADRIG 115
                   :|:.:...|.|..||..:.            |:::  |:|..:|.|  ..||::.   
 Worm    63 FGSCIVCIGYLAFPVPSLLLEDPPNH------------WLNA--AMGQFIAWFGWSIGPLSQ--- 110

  Fly   116 RKWVLLSSSLFFVLAFGLNMVASEVWILYMSRL---IQGFGVGFVMTVQPMYVGEISTDNVRGAT 177
               :||:.:....:.|.|         |||.:.   ....|:||     ..:|..|         
 Worm   111 ---ILLTVNRIIAVYFPL---------LYMKKYRYNPTNVGIGF-----SFFVAFI--------- 149

  Fly   178 GSLMQLFIVGGILYVYA------IGPY---------------VSYQALQWCCIVVPVVFDLVFYM 221
              |:..|...|..|::.      :|.:               ::..||..||.|:     |...:
 Worm   150 --LLVSFFPEGCHYLFNRDYLGWVGEFTPCIDIMQKTFLVVMMTICALTTCCSVL-----LFIKL 207

  Fly   222 MPESPYF------FAGKGRKSEAL 239
            :..||.|      .|.:.||:..|
 Worm   208 IIHSPNFRVSNAQLANRHRKNRKL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1213NP_001246937.1 SP 42..482 CDD:273317 44/255 (17%)
MFS 47..460 CDD:119392 43/250 (17%)
srx-118NP_496675.2 7TM_GPCR_Srx 27..285 CDD:370981 44/255 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.