DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1213 and srx-128

DIOPT Version :9

Sequence 1:NP_001246937.1 Gene:CG1213 / 40728 FlyBaseID:FBgn0037387 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_506426.3 Gene:srx-128 / 186283 WormBaseID:WBGene00006019 Length:339 Species:Caenorhabditis elegans


Alignment Length:262 Identity:49/262 - (18%)
Similarity:90/262 - (34%) Gaps:88/262 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PIT------SDEDAWISSLIAVGALVAPFVAGPMADRIGRKWVLLSSSLFFVLAFGLNMVASEVW 141
            |:|      ::.:.|::||  ||.     |||        .|..|.:.:..|     :|..:..:
 Worm    98 PLTAFSYSYNEVNYWLNSL--VGG-----VAG--------TWAYLLTPILQV-----SMSCNRFY 142

  Fly   142 ILYMSRLIQGFGVGFVMTVQPM-----YVGEISTDNVRGATGSLMQLFIVGGILYVYAIGPYVSY 201
            :||..     ||:..|..| ||     .:..:|...|...|       :..|..|||      ..
 Worm   143 VLYFP-----FGIKLVKKV-PMTNVIITIASLSVSIVAATT-------LPKGCGYVY------DP 188

  Fly   202 QALQW------CCIVVP--VVFDLVFYMMPESPYFFAGKGR----------KSEALK-----SLQ 243
            :.|||      |...|.  :.:.::.:.:..:.:..|...|          |.::.|     .:.
 Worm   189 EFLQWIPEEGKCAETVSSGINYAIIIFTISSNSFNIATASRLLMRKIVGLTKQDSSKRRKRWMIM 253

  Fly   244 FLRGQSAEGVHDEMAEIQANVEEAMASKGTVMDLFKNAGNR--RALFICAGLISFQQLSGINVVL 306
            ||:....:.:|             :........|:|.:...  :.:|:....|:...|.|..:::
 Worm   254 FLQSVMQDCLH-------------LVDSINATYLWKLSEELWFQCIFLTLSFITIYTLDGFVMLV 305

  Fly   307 FN 308
            ||
 Worm   306 FN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1213NP_001246937.1 SP 42..482 CDD:273317 49/262 (19%)
MFS 47..460 CDD:119392 49/262 (19%)
srx-128NP_506426.3 7TM_GPCR_Srx 47..307 CDD:370981 47/260 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.