DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1213 and LOC101882789

DIOPT Version :9

Sequence 1:NP_001246937.1 Gene:CG1213 / 40728 FlyBaseID:FBgn0037387 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_021331508.1 Gene:LOC101882789 / 101882789 -ID:- Length:181 Species:Danio rerio


Alignment Length:138 Identity:39/138 - (28%)
Similarity:66/138 - (47%) Gaps:13/138 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 MTVQPMYVGEISTDNVRGATGSLMQLFIVGGILYVYAIGPYVSYQALQ-WCCI----VVPVVFD- 216
            ||| |:|:.|.|..::||...::..|||..|......|....||...: |..:    |:|.:.. 
Zfish    21 MTV-PVYIAETSPPHLRGRLVTINTLFITAGQFTASVIDGAFSYMKHEGWRYMLGLSVIPALLQF 84

  Fly   217 LVFYMMPESPYFFAGKGRKSEALKSLQFLRGQSAEGVHDEMAEIQANVEEAMASKG----TVMDL 277
            |.|..:||||.:...||...:|.:.|..:||.  :.:.:|...|::::||.....|    .|:.:
Zfish    85 LGFLFLPESPRWLIQKGLTQKARRVLSQIRGN--QNIDEEYDTIKSSIEEEEKDCGGGEKKVLHV 147

  Fly   278 FKNAGNRR 285
            |.:|.:.:
Zfish   148 FTHASSSK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1213NP_001246937.1 SP 42..482 CDD:273317 39/138 (28%)
MFS 47..460 CDD:119392 39/138 (28%)
LOC101882789XP_021331508.1 Sugar_tr <14..>135 CDD:331684 35/116 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.