DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1208 and SGE1

DIOPT Version :9

Sequence 1:NP_001097692.1 Gene:CG1208 / 40727 FlyBaseID:FBgn0037386 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_015524.1 Gene:SGE1 / 856327 SGDID:S000006402 Length:543 Species:Saccharomyces cerevisiae


Alignment Length:422 Identity:77/422 - (18%)
Similarity:148/422 - (35%) Gaps:133/422 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 FGALFGALPSGY-------------IADRIGRRYTAMVMDIPFILAWITLSFANSVGWLYLGRFL 165
            ||.: |.|.:||             :|:.:|.:...|:..|.|.:..:..:.:||:..|..||.:
Yeast    42 FGNI-GWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVV 105

  Fly   166 IGIATGSFCVVAPMYISEIAETSIRGSLGTLFQLLLTIGILFIYVVGALV--------SWKTLSL 222
            .|........:|.:..:.|...:.||.:.|    .|.|..:....||..:        ||:    
Yeast   106 AGFGGSGIESLAFVVGTSIVRENHRGIMIT----ALAISYVIAEGVGPFIGGAFNEHLSWR---- 162

  Fly   223 LCLIIPILLLVGLFIV---------PETPVYLLKNGKRSEANRALKWLWGDYCNTS---NAIQAI 275
            .|..|.:.:....||:         |...::|     .|:..:.:.:.:|:....|   |..:.:
Yeast   163 WCFYINLPIGAFAFIILAFCNTSGEPHQKMWL-----PSKIKKIMNYDYGELLKASFWKNTFEVL 222

  Fly   276 QNDLDQTGVDASVKDLF----------SNRASRNGMVI------SVLLMVFQQF-------SGI- 316
            ...||..|:..|.....          :|....:|::|      .:||::|..:       ||: 
Yeast   223 VFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSGIIICFFTVGPILLLLFCAYDFHFLSLSGLH 287

  Fly   317 ----------------NAVIF------------------FMNEIFESSSTLNPNVCTI---VVGV 344
                            |..||                  ::.::::......|.:.:|   .:.:
Yeast   288 YDNKRIKPLLTWNIASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLWELSI 352

  Fly   345 VQVIMTLASSLLIEKAGRKILLIFSSTIMTVCLAMLGA--YNTINRHTDLSQSIGWLPLLCIVLF 407
            ..:|.|:|.:.|..|.|    :|..:.:..|...::|:  :..||  .:|||||           
Yeast   353 PAMIATMAIAYLNSKYG----IIKPAIVFGVLCGIVGSGLFTLIN--GELSQSI----------- 400

  Fly   408 IVSFSVGYGPIPWMMMGELFMPDVKGIAVSLS 439
                  ||..:|.:..|.:|...:....|.::
Yeast   401 ------GYSILPGIAFGSIFQATLLSSQVQIT 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1208NP_001097692.1 MFS 96..482 CDD:119392 77/422 (18%)
MFS_1 96..443 CDD:284993 77/422 (18%)
SGE1NP_015524.1 MFS_Azr1_MDR_like 24..531 CDD:341045 77/422 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.