DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1208 and CG7882

DIOPT Version :9

Sequence 1:NP_001097692.1 Gene:CG1208 / 40727 FlyBaseID:FBgn0037386 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_610189.2 Gene:CG7882 / 35520 FlyBaseID:FBgn0033047 Length:516 Species:Drosophila melanogaster


Alignment Length:486 Identity:121/486 - (24%)
Similarity:210/486 - (43%) Gaps:73/486 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LGAVAAGTALSWTSPVFPQISAGNESSFNSTTGGISNSTSNEN-----DIRLTDSQKTL----VG 109
            |...|.|::|....||      |..:...::...:..|..||.     |:.|:|:...:    :.
  Fly    40 LNWAAIGSSLGAAVPV------GYCTGVMNSPAELMRSWCNETLIASYDLNLSDAGLEILWSAIV 98

  Fly   110 SMLPFGALFGALPSGYIADRIGRRYTAMVMDIPFILAWITLSF-----ANSVGWLYLGRFLIGIA 169
            |:...|...|::....:|:|.|||....:..:  :|....:||     ..||..|.|||.::|:|
  Fly    99 SIFLVGGAIGSVVGATMANRFGRRGCFFICGL--LLGLGAISFYACRPLRSVELLLLGRMMVGLA 161

  Fly   170 TGSFCVVAPMYISEIAETSIRGSLGTLFQLLLTIGILFIY------VVGALVSWKTLSLLCLIIP 228
            .|.......|:.|||:..|.|.:|..|..:.||:|::...      |:|...:|..         
  Fly   162 GGLLTSFMSMWHSEISALSQRSTLAPLCPMGLTLGVVIAQVCSLRSVLGGPENWHF--------- 217

  Fly   229 ILLLVGLFIV---------PETPVYL-LKNGKRSEANRALKWLWGDYCNTSNAIQAIQNDLDQTG 283
            .|...||.::         ||:|.:| :..|::.:|.|.|:.|.| |...|.|::|...:::|..
  Fly   218 GLAFYGLLVLVCYAPFRWYPESPKWLFIVQGRKEDARRQLQLLRG-YTAGSAALKAEMEEMEQES 281

  Fly   284 V----DASVKDLFSNRASRNGMVISVLLMVFQQFSGINAVIFFMNEIFESS--STLNPNVCTIVV 342
            .    .:|:..:..:...|..::|....:..||.|||||:.::...||..:  |:.......:..
  Fly   282 ACEVKTSSLMQVLRDPQLRLPLIIVCAFLGGQQLSGINAIFYYSVSIFRKAGLSSQASEWANLGA 346

  Fly   343 GVVQVIMTLASSLLIEKAGRKILLIFSSTIMTVCLAMLGAYNTINRHTDLSQSIGWLP---LLCI 404
            |.:.:..::...:|:|:..|:.|::||:....|.|.:....      ....:|..|..   :.||
  Fly   347 GSLNLFASMLGPVLLERVNRRPLMLFSTFFCAVFLLLFAIM------LFFIESYSWFGMGCIGCI 405

  Fly   405 VLFIVSFSVGYGPIPWMMMGELFMPDVKGIAVSLSVMMNWVCVSLVTWLFGVL-NAGGADVPFWF 468
            .|:|..|..|.||:|:.:..|||....:..|:||..:..|:|..::...|..: |..||.| |..
  Fly   406 FLYIFFFQFGLGPMPFFIGAELFELATRPAAMSLGSLAYWLCNFIIGMAFPTMQNLWGALV-FLP 469

  Fly   469 FSAW----MGVATAYVAIALQETKGKSASQI 495
            ||..    .|:...|    |.||:|:..|::
  Fly   470 FSVTCLLIFGLTKRY----LPETRGRHPSEV 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1208NP_001097692.1 MFS 96..482 CDD:119392 106/429 (25%)
MFS_1 96..443 CDD:284993 94/385 (24%)
CG7882NP_610189.2 Sugar_tr 43..491 CDD:278511 118/476 (25%)
MFS 95..480 CDD:119392 101/403 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.