DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1208 and CG8837

DIOPT Version :9

Sequence 1:NP_001097692.1 Gene:CG1208 / 40727 FlyBaseID:FBgn0037386 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster


Alignment Length:499 Identity:122/499 - (24%)
Similarity:210/499 - (42%) Gaps:94/499 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ICLGAVAAGTALSWTSPVFPQISAGNESSFN-STTGGI--SNSTSNENDIRLTDSQKT------- 106
            :||.....|.|:...:     .:.||...|| ....||  ::.|..|::.|...:|.|       
  Fly     1 MCLPKRVGGPAIQSVA-----TALGNILCFNFGLMFGITPAHMTLYESEERTPLNQATDPAGTAW 60

  Fly   107 LVGSMLPFGALFGALPSGYIADRIGRRYTAMVMDIPFILAWITLSFANSVGWLYLGRFLIGIATG 171
            |.|.:. ..|..|||.||::|.:||.:...:...:..|..|..:.|...:..:|..|...|:|:|
  Fly    61 LTGYLF-LSAALGALVSGFLALKIGPKSVLLCSGLLQISGWACIHFGYDIVHIYASRLFAGVASG 124

  Fly   172 SFCVVAPMYISEIAETSIRGS-LGTLFQLLLTIGILFIYVVGALVSWKTLSLLCLIIPILLLVGL 235
            :..||.|::|:||||:..:.: |....:|..|:|||..:|:|..|.:..::::...:..:..:..
  Fly   125 AAFVVLPIFINEIAESREKAARLTFTIELWRTLGILIGFVLGFYVPYAFVNIVGCAVSFVFTMTF 189

  Fly   236 FIVPETPVYLLKNGKRSEANRALKWLWG----------DYCNTSNAIQAIQNDLDQTGVDASVKD 290
            ..|.|:|.|.|:....:...::|:|..|          :|.:..|...|.....|        |:
  Fly   190 PFVQESPHYYLRKNNMASLEKSLRWYRGIRDIDDREKPEYLSELNEFHAELRSRD--------KN 246

  Fly   291 LFSNRASRNGMV----ISVLLMVFQQFSGI----NAVIFFMNEIFESSSTLNPNVCTIVVGVVQV 347
            :.|...|...::    :|.||.|..:.||:    |....|:.....|:.|   |.  :|:...|.
  Fly   247 VGSTPMSHGYIIRLTFVSFLLTVCAKLSGVFVELNYAADFLGRTGYSTET---NY--VVLASAQC 306

  Fly   348 IMTLASSLLIEKAGRKILLIFSS---TIMTVCLAMLGAY-------NTINRHTDLSQSIGWLP-- 400
            ...|.:.|:..:..||:||..||   ....:.||:..||       |..:|         :||  
  Fly   307 AGALLARLVGPRLPRKLLLCLSSLFAAAAVIALALFKAYGHLWLLGNWADR---------YLPII 362

  Fly   401 LLCIVLFIVSFSVGYGPIPWMMMGELFMPDVKGIAVSLSVMMNWVCVSLVTWLFGVLN------- 458
            ||.|.|.:|||  |..|:..::..|:....:..:..||:..::|:.      |||::.       
  Fly   363 LLAIQLALVSF--GLYPLAAVVSSEVLPTKLHDLLYSLASAVSWLL------LFGMIEAFNAVKA 419

  Fly   459 --AGGADVPFWFFSAWMGVATAYVAI----ALQETKGKSASQIQ 496
              |.|..:..|.|:.    |:.:|.:    .|.||:.:..|.:|
  Fly   420 TIAPGLLLYLWVFAG----ASIFVGLISLPLLPETRNRRPSAVQ 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1208NP_001097692.1 MFS 96..482 CDD:119392 105/432 (24%)
MFS_1 96..443 CDD:284993 95/384 (25%)
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 36/138 (26%)
Sugar_tr 58..453 CDD:278511 105/429 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444384
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.