DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1208 and CG33281

DIOPT Version :9

Sequence 1:NP_001097692.1 Gene:CG1208 / 40727 FlyBaseID:FBgn0037386 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster


Alignment Length:479 Identity:137/479 - (28%)
Similarity:228/479 - (47%) Gaps:53/479 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QYVAAMIICLGAVAAGTALSWTSPVFPQISAGNESSFNSTTGGISNSTSNENDIRLTDSQKTLVG 109
            ||:||:.:.:.:::.|....|.|..|.::|:.|..   ..||            .||.:.:..|.
  Fly    10 QYLAAISVNIISISYGAFCGWPSSSFLELSSENSP---LDTG------------PLTPTDQGWVA 59

  Fly   110 SMLPFGALFGALPSGYIADRIGRRYTAMVMDIPFILAWITLSFANSVGWLYLGRFLIGIATGSFC 174
            |.:..|.|.|.....::||||||:...|.|.:|.:|.|:.:.||.:...|.:.||:.|.|.|...
  Fly    60 SNICLGGLVGTFLFTWLADRIGRKLCLMWMALPNLLGWVIIPFARTPMHLIIARFIGGAAGGGCF 124

  Fly   175 VVAPMYISEIAETSIRGSLGTLFQLLLTIGILFIYVVG-----ALVSWKTLSLLCLIIPILLLVG 234
            .|.|:||:|:|..:|||.||....|....|::..:|:|     |.|||...||      ..:.||
  Fly   125 TVIPIYIAELASDNIRGILGVFLVLTCNFGLVLAFVLGYYFNYAQVSWIVSSL------SFVFVG 183

  Fly   235 LF-IVPETPVYLLKNGKRSEANRALKWLWGDYCN-TSNAIQAIQNDL----------DQTGVDAS 287
            .| .:||||.:|.|..|..||..:|::    |.| .||..:.:..:|          ::|..|..
  Fly   184 CFWFMPETPQHLAKINKIEEAEHSLRY----YRNIKSNPAKELSEELQLELQKLKTTEKTTADGV 244

  Fly   288 VKD---------LFSNRASRNGMVISVLLMVFQQFSGINAVIFFMNEIFE-SSSTLNPNVCTIVV 342
            ..|         .|:...:|...:|.:.|:.|.|..|..|::.:...||| :.|:|.|.|..|:|
  Fly   245 DDDDAATGVTWSDFAEGKTRKAFLIGLGLISFNQLCGCFAMLNYTAVIFEQAGSSLPPTVAAIIV 309

  Fly   343 GVVQVIMTLASSLLIEKAGRKILLIFSSTIMTVCLAMLGAYNTINRHTDLSQSIGWLPLLCIVLF 407
            ||:|::.|.||::|:|:.||||||:.|:..:.:..:.:|.|:..........|..|:|:......
  Fly   310 GVIQLMGTYASTVLVERLGRKILLLVSAVGIGLGQSAMGTYSYFQMLGCPVASFSWVPIAGFSFM 374

  Fly   408 IVSFSVGYGPIPWMMMGELFMPDVKGIAVSLSVMMNWVCVSLVTWLFGVLNAG-GADVPFWFFSA 471
            :...:||...:|::::.|:....::..|:.:.:...|:..:....|..|.... |.....:.|::
  Fly   375 LFLAAVGLLSLPFLVVSEIMPQKIRSTAIMILMSTLWLISTCAVKLMPVFTESLGMHGTVFMFAS 439

  Fly   472 WMGVATAYVAIALQETKGKSASQI 495
            ...:|..::||.:.||||||...|
  Fly   440 LSFLAAIFIAIFVPETKGKSVDAI 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1208NP_001097692.1 MFS 96..482 CDD:119392 116/413 (28%)
MFS_1 96..443 CDD:284993 110/373 (29%)
CG33281NP_995620.1 MFS 50..452 CDD:119392 118/411 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444453
Domainoid 1 1.000 165 1.000 Domainoid score I819
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48021
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.