DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1208 and K09C4.2

DIOPT Version :9

Sequence 1:NP_001097692.1 Gene:CG1208 / 40727 FlyBaseID:FBgn0037386 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:88 Identity:21/88 - (23%)
Similarity:41/88 - (46%) Gaps:8/88 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 SVGYGPIPWMMMGELFMPDVKGIAVSLSVMMNWVCVSL-VTWLFGVLNAGGAD---VPFWFFSAW 472
            :.|...|..:.:.|||.|..:.: |..:::...:.|.: |..||.::|:..:.   |||......
 Worm    11 ATGANAIRLLFVTELFPPSARTV-VGQAMLFGSMAVGMPVVSLFPIINSIFSPIFFVPFVIVQTV 74

  Fly   473 MGVATAYVAIALQETKGKSASQI 495
            .|:   |:...:.||:|::...|
 Worm    75 FGI---YLYRYMPETRGRAVYDI 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1208NP_001097692.1 MFS 96..482 CDD:119392 17/73 (23%)
MFS_1 96..443 CDD:284993 7/30 (23%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.