DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob3 and MB

DIOPT Version :9

Sequence 1:NP_649597.3 Gene:glob3 / 40726 FlyBaseID:FBgn0037385 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001349775.1 Gene:MB / 4151 HGNCID:6915 Length:154 Species:Homo sapiens


Alignment Length:142 Identity:33/142 - (23%)
Similarity:52/142 - (36%) Gaps:47/142 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YPKRIPKI-KFGPIKDEMGFTLSERLALRQAWNLVRPFERRYGQDVFYSFLNDYYWGIKKFRNGA 81
            :|:.:.|. ||..:|.|.....||.|             :::|..|..:.     .||.|.:...
Human    37 HPETLEKFDKFKHLKSEDEMKASEDL-------------KKHGATVLTAL-----GGILKKKGHH 83

  Fly    82 ELNVKAL-HSHALRFINFFGLLIEEKDPVVFQLMINDNNHTHNRC--------HVGSVNIGHLAQ 137
            |..:|.| .|||.:          .|.||.:...|::       |        |.|  :.|..||
Human    84 EAEIKPLAQSHATK----------HKIPVKYLEFISE-------CIIQVLQSKHPG--DFGADAQ 129

  Fly   138 ALVDYVLKVFHK 149
            ..::..|::|.|
Human   130 GAMNKALELFRK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob3NP_649597.3 Mb_like 44..169 CDD:271266 24/115 (21%)
MBNP_001349775.1 Mb 6..154 CDD:271277 33/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.