DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dgrn and RMA3

DIOPT Version :10

Sequence 1:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_194477.2 Gene:RMA3 / 828856 AraportID:AT4G27470 Length:243 Species:Arabidopsis thaliana


Alignment Length:72 Identity:19/72 - (26%)
Similarity:32/72 - (44%) Gaps:12/72 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 ESQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAIRA----------THKCPICNKKLTA 311
            ::.:...:.|.||:|:.  .:||.|.|||:||..||...:..          .:.||:|...:|.
plant    35 QANESGCFDCNICLDTA--HDPVVTLCGHLFCWPCIYKWLHVQLSSVSVDQHQNNCPVCKSNITI 97

  Fly   312 RQFFRIY 318
            .....:|
plant    98 TSLVPLY 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dgrnNP_649596.1 PEX10 <182..308 CDD:227861 17/60 (28%)
RING_Ubox 264..315 CDD:473075 18/60 (30%)
RMA3NP_194477.2 PLN03208 37..228 CDD:178747 19/70 (27%)

Return to query results.
Submit another query.