DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dgrn and XB5729975

DIOPT Version :10

Sequence 1:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001039218.1 Gene:XB5729975 / 734077 XenbaseID:XB-GENE-5729976 Length:550 Species:Xenopus tropicalis


Alignment Length:53 Identity:21/53 - (39%)
Similarity:28/53 - (52%) Gaps:8/53 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 CPICMDSVSKREPVSTKCGHVFCRECIETAIR------ATHKCPICNKKLTAR 312
            |.||:|..  |:||..:|||.||::||.....      |.:.||.|.|:..||
 Frog    12 CSICLDFY--RKPVILRCGHNFCQDCIAGVFNTQEEESAFYTCPECRKRFKAR 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dgrnNP_649596.1 PEX10 <182..308 CDD:227861 18/47 (38%)
RING_Ubox 264..315 CDD:473075 21/53 (40%)
XB5729975NP_001039218.1 RAD18 6..>303 CDD:227719 21/53 (40%)
RING_Ubox 6..67 CDD:473075 21/53 (40%)
SPRY_PRY_C-I_2 366..531 CDD:293949
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.