DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dgrn and PEX10

DIOPT Version :10

Sequence 1:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_722540.1 Gene:PEX10 / 5192 HGNCID:8851 Length:346 Species:Homo sapiens


Alignment Length:54 Identity:20/54 - (37%)
Similarity:32/54 - (59%) Gaps:4/54 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 CPICMDSVSKREPVSTKCGHVFCRECIETAIRATHKCPICNKKLTARQFFRIYL 319
            |.:|::  .:|.|.:|.|||:||.|||.....:..:||:|.:|...::.  |||
Human   293 CTLCLE--ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKL--IYL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dgrnNP_649596.1 PEX10 <182..308 CDD:227861 16/41 (39%)
RING_Ubox 264..315 CDD:473075 17/48 (35%)
PEX10NP_722540.1 Pex2_Pex12 18..263 CDD:398431
RING-HC_PEX10 293..342 CDD:438190 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.