DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dgrn and pex10

DIOPT Version :10

Sequence 1:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001005994.1 Gene:pex10 / 449821 ZFINID:ZDB-GENE-041010-71 Length:318 Species:Danio rerio


Alignment Length:55 Identity:19/55 - (34%)
Similarity:31/55 - (56%) Gaps:4/55 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 KCPICMDSVSKREPVSTKCGHVFCRECIETAIRATHKCPICNKKLTARQFFRIYL 319
            :|.:|::  .:|...||.|||:||.|||.......::||:|.:|....:.  :||
Zfish   264 RCILCLE--ERRNTTSTPCGHLFCWECITEWCNTKNECPLCREKFQPHRL--VYL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dgrnNP_649596.1 PEX10 <182..308 CDD:227861 16/42 (38%)
RING_Ubox 264..315 CDD:473075 17/49 (35%)
pex10NP_001005994.1 Pex2_Pex12 18..237 CDD:398431
RING-HC_PEX10 263..314 CDD:438190 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.