DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dgrn and CG17329

DIOPT Version :10

Sequence 1:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster


Alignment Length:114 Identity:39/114 - (34%)
Similarity:56/114 - (49%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RSRTVNLHSNDSL---TILPRRSAENDPVVDLDVASPPKRVNRDIDESQKEELYKCPICM----D 271
            |.|.:.|.....|   |:..|.....:.|:..::.|..|.:|:.:|  :..|...|.||:    |
  Fly    47 RRRILRLLQGKMLQYATLEERLHRIGELVLIAELHSGVKTLNQRLD--RMVENSTCSICLLPWTD 109

  Fly   272 SVSKREPVSTKCGHVFCRECIETAIRATHKCPICNKKLTARQFF--RIY 318
            :...| .||.:|||:|...||..|||..|:||||.::  ||.|.  |||
  Fly   110 NGIHR-LVSLRCGHLFGSSCIHMAIRRNHRCPICRRR--ARHFHVRRIY 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dgrnNP_649596.1 PEX10 <182..308 CDD:227861 33/100 (33%)
RING_Ubox 264..315 CDD:473075 23/54 (43%)
CG17329NP_609784.2 HRD1 <36..>144 CDD:227568 33/99 (33%)
RING_Ubox 96..155 CDD:473075 26/61 (43%)

Return to query results.
Submit another query.