DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dgrn and CG32847

DIOPT Version :10

Sequence 1:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster


Alignment Length:65 Identity:19/65 - (29%)
Similarity:34/65 - (52%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 ESQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAI--RATHK-CPICNKKLTARQFFRIY 318
            :::.|..|:|.||:|:.  :..|.:.|||:||..|:...|  :..|. ||:|...:...:...:|
  Fly     9 DTKDESFYECNICLDTA--QNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVY 71

  Fly   319  318
              Fly    72  71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dgrnNP_649596.1 PEX10 <182..308 CDD:227861 18/53 (34%)
RING_Ubox 264..315 CDD:473075 17/53 (32%)
CG32847NP_730026.1 RING_Ubox 16..71 CDD:473075 17/56 (30%)

Return to query results.
Submit another query.