DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec20 and SEC20

DIOPT Version :9

Sequence 1:NP_001287187.1 Gene:Sec20 / 40724 FlyBaseID:FBgn0037383 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_010786.3 Gene:SEC20 / 852109 SGDID:S000002906 Length:383 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:59/310 - (19%)
Similarity:95/310 - (30%) Gaps:117/310 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IRQDLIDNNLQAKAII----------HDILNSRTSIA----------ELEELNEAGRSKLSAI-- 53
            :.||.:.||||..:.|          ||..:|..:||          |.|:|.....||:|..  
Yeast    11 VLQDALLNNLQKLSAISRRKESGESKHDNKDSFAAIANEHNDEEEEIEFEDLVNIIESKVSDFES 75

  Fly    54 --------------------RKS--------------------------IERLD------DW--- 63
                                .||                          :|.||      ||   
Yeast    76 VLKCSIVEMTYKYPELKLQWEKSPRYDQCDKLHIVKLDKQMNEDIYAQLVEELDFVLQFVDWFYC 140

  Fly    64 -------------ARDTA--DSALANEVDDHRDQFSKTLQAFRKANVSTMLEIEKAN-REELMAI 112
                         .||.|  |......:..|...:.|..|....::..|...:|||: ||:|:  
Yeast   141 YRLKVKEILRQHHKRDLAWNDEKRDRAIKFHAVDYDKLHQGTSSSSSLTSTSMEKASTREKLL-- 203

  Fly   113 TGESELRQRTTTRARHNQGSLVSQENDVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSD 177
               |:.:|.|....|.||                   .|.....:|.:.|:.|.|.:.::....|
Yeast   204 ---SKTKQLTNNLVRGNQ-------------------ILQSGILQSDLNLDELRAQTNSLTQIDD 246

  Fly   178 ELHHTAGSISMSGKLLKKYGRRECTDKMLLFFAFSLFLACVFYIVQKRLF 227
            :..........:..|:|........:|..::.:....|.||.:::.:|:|
Yeast   247 KYTQFETVFKKTADLVKVLENASHQEKRDVYLSLGFLLCCVSWVLWRRIF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec20NP_001287187.1 Sec20 135..226 CDD:112708 12/90 (13%)
SEC20NP_010786.3 Sec20 204..295 CDD:112708 18/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12825
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.