DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec20 and bnip1b

DIOPT Version :9

Sequence 1:NP_001287187.1 Gene:Sec20 / 40724 FlyBaseID:FBgn0037383 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_001333725.2 Gene:bnip1b / 795732 ZFINID:ZDB-GENE-120203-6 Length:232 Species:Danio rerio


Alignment Length:219 Identity:88/219 - (40%)
Similarity:131/219 - (59%) Gaps:11/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QDLIDNNLQAKAIIHDILNSRTSIAELEELNEAGRSKLSAIRKSIERLDDWA----RDTADSALA 73
            |::|..:|:.||||.||.......|.|.|||...:.|.|.:|:.|:.::..|    |:|...||.
Zfish    18 QEIIKYDLEIKAIIQDIRECCGPQAVLMELNSTVKEKFSLLRQRIQDMEQMAKEQDRETDKQALL 82

  Fly    74 NEVDDHRDQFSKTLQAFRKANVSTMLEIEKANREELMAITGESELRQRTTTRARHNQGSLVSQEN 138
            :|.:.||.|......|:||||::..|.|:...::||  :.|...:|||..|:.     |||...:
Zfish    83 SETEGHRKQMLSNQMAWRKANLACKLAIDNLEKDEL--LQGGDAVRQRKATKE-----SLVQTSS 140

  Fly   139 DVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTD 203
            |:||.:::|||.:|:..|:|..|:.|||.||:.|:.|::|.....|:|.:..||:.||.|||.||
Zfish   141 DITESLMSISRMMSQQVQQSDETIGTLVTSSRTVQETNEEFKAMTGTIHLGRKLILKYNRRELTD 205

  Fly   204 KMLLFFAFSLFLACVFYIVQKRLF 227
            |:|:|.|.:||||.|.||::||||
Zfish   206 KLLIFLAIALFLATVLYILKKRLF 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec20NP_001287187.1 Sec20 135..226 CDD:112708 41/90 (46%)
bnip1bXP_001333725.2 SNARE_SEC20 136..228 CDD:277218 42/91 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596743
Domainoid 1 1.000 88 1.000 Domainoid score I7903
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H930
Inparanoid 1 1.050 148 1.000 Inparanoid score I4368
OMA 1 1.010 - - QHG55915
OrthoDB 1 1.010 - - D1328108at2759
OrthoFinder 1 1.000 - - FOG0004333
OrthoInspector 1 1.000 - - otm24455
orthoMCL 1 0.900 - - OOG6_103788
Panther 1 1.100 - - LDO PTHR12825
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.