DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec20 and bnip1a

DIOPT Version :9

Sequence 1:NP_001287187.1 Gene:Sec20 / 40724 FlyBaseID:FBgn0037383 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_021328462.1 Gene:bnip1a / 565822 ZFINID:ZDB-GENE-081107-44 Length:229 Species:Danio rerio


Alignment Length:219 Identity:76/219 - (34%)
Similarity:128/219 - (58%) Gaps:10/219 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QDLIDNNLQAKAIIHDILNSRTSIAELEELNEAGRSKLSAIRKSIERLDDWARDTADSA----LA 73
            |::|..:|:.||::.|:.......::|.:||...:.|.:.:|:.|:.|:..:::....:    |.
Zfish    14 QEIIKFDLELKALVQDVNECTGPQSKLTDLNLIVKEKFNKLRQRIQDLEQMSKEQDKESDKLMLL 78

  Fly    74 NEVDDHRDQFSKTLQAFRKANVSTMLEIEKANREELMAITGESELRQRTTTRARHNQGSLVSQEN 138
            .:|:.||.|......|:||||::..|.|:|..:|:|:. :.:..:|.|..|:.     ||....:
Zfish    79 LKVEGHRKQMLSNQTAWRKANLACKLSIDKLEKEDLLN-SEDMSVRHRKMTKE-----SLAQTSS 137

  Fly   139 DVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTD 203
            |:||.:::|||.:|:..|:|..|:.||..||:.|..|.:|.....|:|.:..||:.||.|||.||
Zfish   138 DITESLMSISRMMSQQVQQSEETMGTLATSSRTVLETHEEFKAMTGTIQLGRKLIIKYNRRELTD 202

  Fly   204 KMLLFFAFSLFLACVFYIVQKRLF 227
            |:|:|.|.:||||.|.||::||||
Zfish   203 KLLIFLALALFLATVLYILKKRLF 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec20NP_001287187.1 Sec20 135..226 CDD:112708 40/90 (44%)
bnip1aXP_021328462.1 SNARE_SEC20 133..225 CDD:277218 40/91 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596744
Domainoid 1 1.000 88 1.000 Domainoid score I7903
eggNOG 1 0.900 - - E1_28N8I
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H930
Inparanoid 1 1.050 148 1.000 Inparanoid score I4368
OMA 1 1.010 - - QHG55915
OrthoDB 1 1.010 - - D1328108at2759
OrthoFinder 1 1.000 - - FOG0004333
OrthoInspector 1 1.000 - - otm24455
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12825
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3048
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.