DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec20 and sec20

DIOPT Version :9

Sequence 1:NP_001287187.1 Gene:Sec20 / 40724 FlyBaseID:FBgn0037383 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_594444.1 Gene:sec20 / 2541996 PomBaseID:SPAC23A1.15c Length:226 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:47/224 - (20%)
Similarity:88/224 - (39%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DILNS-RTSIAELE--ELNEAGRSKLSAIRKSIE--RLD-DWARDTADSALANEVDDHRDQFSKT 86
            |:||: ...:.||:  |..|..:......||..|  |:: :::....||.|         ::.|.
pombe     3 DVLNALEEKVVELQQSESVEVIKRHFREFRKIWETARVELEYSSIQLDSVL---------RYEKA 58

  Fly    87 LQAFRKAN-------------VSTMLEIEKANREELMAITGESELRQRTTTRARHNQGSLVSQE- 137
            :|.:.:.|             :....||.|...||.:....:..|::    |:..|.||..|.: 
pombe    59 VQEYIRLNRRYRNKIASGEPWLPIAQEIGKIVDEEEITSPSDGSLQK----RSMDNSGSWQSDDI 119

  Fly   138 -----NDVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYG 197
                 :.||..|..|...:.:....||.....|.:|:..:|...::.......:..|.:::|...
pombe   120 YLTSASQVTAAMRDIHAQMVQAVDMSAENAMELSSSTNLLETLQEKYFGVEDVLYTSKRIIKSLK 184

  Fly   198 RRECTDKMLLFFAFSLFLACVFYIVQKRL 226
            ..:.:|..|:...|..|:..|.|::.||:
pombe   185 LSDRSDYFLVVSGFGFFIFVVVYLLFKRI 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec20NP_001287187.1 Sec20 135..226 CDD:112708 19/96 (20%)
sec20NP_594444.1 Sec20 122..213 CDD:112708 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004333
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103788
Panther 1 1.100 - - LDO PTHR12825
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.