DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42675 and ZC2HC1C

DIOPT Version :9

Sequence 1:NP_001262302.1 Gene:CG42675 / 40722 FlyBaseID:FBgn0261561 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_078919.2 Gene:ZC2HC1C / 79696 HGNCID:20354 Length:456 Species:Homo sapiens


Alignment Length:342 Identity:75/342 - (21%)
Similarity:120/342 - (35%) Gaps:126/342 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WAARRLMEALSHLPPSGNSSTNSAPMRFQQRTQQEQEVRRRELM------STKSSAENLATGAPS 96
            |...|.:||      :|.|              .|:|:||::::      .|:.....:.|....
Human   210 WVQIRRLEA------AGES--------------LEEEIRRKQILLRGKLKKTEEELRRIQTQKEQ 254

  Fly    97 AATTRLIGNGKVRQMFDERRRGAGIDRSNPL-KPIGTLPSPP-------------------AQTK 141
            |....   ||:::::...|.|..| ::||.: |||.   ||.                   :|..
Human   255 AKENE---NGELQKIILPRSRVKG-NKSNTMYKPIF---SPEFEFEEEFSRDRREDETWGRSQQN 312

  Fly   142 SRP----QPPMQRLVKGVADLTMRDAPNAPGRRITSDSNNNKFATPRGTLNRNLKPVVTRKTPPA 202
            |.|    ...:|||                 :|....::|||...|..      :|.|.:.:||:
Human   313 SGPFQFSDYRIQRL-----------------KRERLVASNNKIRDPVS------EPSVEKFSPPS 354

  Fly   203 QETTLHQRSPAPQRSPKIQATQRVSGGTGAAPTAGRLSPPFVRRAEPKSPVKKVNMDTTTAIPEG 267
            :......:..|...|..:......|.|:...|..|.                             
Human   355 ETPVGALQGSARNSSLSMAPDSSGSSGSIEEPQLGE----------------------------- 390

  Fly   268 TALCRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAF-NMKSKGNRNRSTYSS 331
               |.:|||.|.:.||.:|..:|.||..:|||:||:|:.|.:|||...: |.|...       |:
Human   391 ---CSHCGRKFLSFRLERHSNICSRMRGSKRKVFDSSRARAKGTELEQYLNWKGPA-------SA 445

  Fly   332 AAQQKGLTTGVKKNNWR 348
            .|:..      :|:|||
Human   446 KAEPP------QKSNWR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42675NP_001262302.1 zf-C2HC_2 271..291 CDD:290624 8/19 (42%)
zf-C2HC_2 389..410 CDD:290624
ZC2HC1CNP_078919.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..388 12/57 (21%)
zf-C2HC_2 387..411 CDD:290624 9/55 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108928
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1390
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.670

Return to query results.
Submit another query.