DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42675 and Zc2hc1b

DIOPT Version :9

Sequence 1:NP_001262302.1 Gene:CG42675 / 40722 FlyBaseID:FBgn0261561 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_083448.1 Gene:Zc2hc1b / 75122 MGIID:1922372 Length:172 Species:Mus musculus


Alignment Length:143 Identity:64/143 - (44%)
Similarity:86/143 - (60%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 CRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYSSAAQQ 335
            |..|||.|.||.|.:|..:|:::...|||.|::.|||::||:.             .|...:.|.
Mouse    18 CEVCGRCFATDVLERHGPICKKVFNKKRKPFNSLKQRLQGTDI-------------PTVGKSPQP 69

  Fly   336 KGLTTGVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPP-PSENPDYVQCPHCGRRFN 399
            |  ...|:|:|||::|||||.:||:|||....:..|   ..||||| |:.||||:|||:|.||||
Mouse    70 K--VQPVRKSNWRQQHEDFINTIRSAKQFTLAIKEG---RPLPPPPRPTSNPDYIQCPYCMRRFN 129

  Fly   400 EQAAERHIPKCVN 412
            |.||:|||..|.|
Mouse   130 ETAAQRHINFCKN 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42675NP_001262302.1 zf-C2HC_2 271..291 CDD:290624 9/19 (47%)
zf-C2HC_2 389..410 CDD:290624 14/20 (70%)
Zc2hc1bNP_083448.1 zf-C2HC_2 15..38 CDD:290624 9/19 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..77 5/33 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838345
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004293
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2959
SonicParanoid 1 1.000 - - X1390
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.