DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42675 and ZC2HC1A

DIOPT Version :9

Sequence 1:NP_001262302.1 Gene:CG42675 / 40722 FlyBaseID:FBgn0261561 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001349898.1 Gene:ZC2HC1A / 51101 HGNCID:24277 Length:364 Species:Homo sapiens


Alignment Length:165 Identity:71/165 - (43%)
Similarity:91/165 - (55%) Gaps:27/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 CRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAFN-MKSKGNRNRSTYSSAAQ 334
            |:.|||.|....|.||..:||:..|.|||.||:|:||.|||:..... :|.:....:        
Human    19 CKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPK-------- 75

  Fly   335 QKGLTTGVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENPDYVQCPHCGRRFN 399
                    |.:|||:|||:||.:|||||.:...|..||||.  ||||||.:|||:|||:|.||||
Human    76 --------KPSNWRRKHEEFIATIRAAKGLDQALKEGGKLP--PPPPPSYDPDYIQCPYCQRRFN 130

  Fly   400 EQAAERHIPKCVNM---VHNKPR-----NGPPAKR 426
            |.||:|||..|...   :.||.:     .|.|..|
Human   131 ENAADRHINFCKEQAARISNKGKFSTDTKGKPTSR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42675NP_001262302.1 zf-C2HC_2 271..291 CDD:290624 8/19 (42%)
zf-C2HC_2 389..410 CDD:290624 14/20 (70%)
ZC2HC1ANP_001349898.1 zf-C2HC_2 15..39 CDD:316435 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9575
eggNOG 1 0.900 - - E1_KOG3940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004293
OrthoInspector 1 1.000 - - otm41098
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2959
SonicParanoid 1 1.000 - - X1390
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.