DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42675 and zc2hc1a

DIOPT Version :9

Sequence 1:NP_001262302.1 Gene:CG42675 / 40722 FlyBaseID:FBgn0261561 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_955974.1 Gene:zc2hc1a / 324412 ZFINID:ZDB-GENE-030131-3132 Length:327 Species:Danio rerio


Alignment Length:164 Identity:70/164 - (42%)
Similarity:98/164 - (59%) Gaps:14/164 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 CRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYSSAAQQ 335
            |:.|||.|....|.||..:||:....:||:||:.:||.||||.:  .:|....:.:|:.||:...
Zfish    17 CKICGRSFFPKVLKKHVPICQKTAAKRRKVFDSGRQRAEGTEIS--TVKPIKPKLQSSSSSSKSD 79

  Fly   336 KGLTTGVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENPDYVQCPHCGRRFNE 400
            |. ....|::|||:|||:||.:|||||.:...:..||.|.  ||||||.:|||:|||:|.|||.|
Zfish    80 KP-EPPKKQSNWRRKHEEFIATIRAAKSINQVIKDGGPLP--PPPPPSYDPDYIQCPYCQRRFGE 141

  Fly   401 QAAERHIPKC---VNMVHNK------PRNGPPAK 425
            .||:|||..|   .:.:.||      .:..|||:
Zfish   142 NAADRHIKFCKEQASRISNKSKLAGGDKTKPPAR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42675NP_001262302.1 zf-C2HC_2 271..291 CDD:290624 8/19 (42%)
zf-C2HC_2 389..410 CDD:290624 13/20 (65%)
zc2hc1aNP_955974.1 zf-C2HC_2 13..37 CDD:290624 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..96 21/58 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..131 12/24 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..271 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9150
eggNOG 1 0.900 - - E1_KOG3940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004293
OrthoInspector 1 1.000 - - oto39067
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2959
SonicParanoid 1 1.000 - - X1390
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.