DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42675 and T03G11.3

DIOPT Version :9

Sequence 1:NP_001262302.1 Gene:CG42675 / 40722 FlyBaseID:FBgn0261561 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_508879.4 Gene:T03G11.3 / 188032 WormBaseID:WBGene00020196 Length:322 Species:Caenorhabditis elegans


Alignment Length:149 Identity:56/149 - (37%)
Similarity:78/149 - (52%) Gaps:18/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 EGTALCRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYS 330
            |.|..|..|.|.|....|.|||..|:::.:..||.||:.|||..|::....::|           
 Worm     8 EPTFPCPICDRRFIKSSLEKHESACRKLASLHRKPFDSGKQRASGSDLTYADIK----------- 61

  Fly   331 SAAQQKGLTTGV---KKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENP-DYVQC 391
            ....:|....||   .:.|||::|.:||.::.::|:|...|..|   :.|||||.:..| |||||
 Worm    62 KVQHEKNKNGGVFPRPQTNWRERHGNFIDAVSSSKRVDYALKTG---APLPPPPKTAVPSDYVQC 123

  Fly   392 PHCGRRFNEQAAERHIPKC 410
            .:|.|.||..|||||||.|
 Worm   124 EYCSRNFNAAAAERHIPFC 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42675NP_001262302.1 zf-C2HC_2 271..291 CDD:290624 8/19 (42%)
zf-C2HC_2 389..410 CDD:290624 14/20 (70%)
T03G11.3NP_508879.4 zf-C2HC_2 9..33 CDD:290624 9/23 (39%)
zf-C2HC_2 121..143 CDD:290624 15/22 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004293
OrthoInspector 1 1.000 - - oto17565
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2959
SonicParanoid 1 1.000 - - X1390
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.