DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42675 and ZC2HC1B

DIOPT Version :9

Sequence 1:NP_001262302.1 Gene:CG42675 / 40722 FlyBaseID:FBgn0261561 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001013645.1 Gene:ZC2HC1B / 153918 HGNCID:21174 Length:222 Species:Homo sapiens


Alignment Length:155 Identity:65/155 - (41%)
Similarity:87/155 - (56%) Gaps:19/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 CRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYSSAAQQ 335
            |..|||.|..|.|.:|..:|:::...|||.|.:.|||::||:.             .|.....|.
Human    18 CEVCGRRFAADVLERHGPICKKLFNRKRKPFSSLKQRLQGTDI-------------PTVKKTPQS 69

  Fly   336 KGLTTGVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENPDYVQCPHCGRRFNE 400
            |  :..|:|:|||::|||||.:||:|||....:..|..|.  ||||||.||||:|.|:|.|||||
Human    70 K--SPPVRKSNWRQQHEDFINAIRSAKQCMLAIKEGRPLP--PPPPPSLNPDYIQRPYCMRRFNE 130

  Fly   401 QAAERHIPKCVNMVHNKPRNGPPAK 425
            .|||||...|.:....:..|  ||:
Human   131 SAAERHTNFCKDQSSRRVFN--PAQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42675NP_001262302.1 zf-C2HC_2 271..291 CDD:290624 8/19 (42%)
zf-C2HC_2 389..410 CDD:290624 13/20 (65%)
ZC2HC1BNP_001013645.1 zf-C2HC_2 14..38 CDD:316435 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..78 11/44 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004293
OrthoInspector 1 1.000 - - otm41098
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1390
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.