powered by:
Protein Alignment PSMG1 and Psmg1
DIOPT Version :9
Sequence 1: | NP_649590.1 |
Gene: | PSMG1 / 40719 |
FlyBaseID: | FBgn0037378 |
Length: | 235 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_062410.1 |
Gene: | Psmg1 / 56088 |
MGIID: | 1860263 |
Length: | 289 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 31/66 - (46%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 164 LEAPNFIAGVAAGVASWRDQMELPVTSFVIYTDKLPLDATAAQPVIKVLKAAGVACSSSYIPPRK 228
||.||.:..::|.|.|:....::|...::.|||.:.||....:....:|.:..:.|....||...
Mouse 207 LEQPNIVHDLSAAVLSYCQVWKIPAVLYLCYTDVMKLDRVTVEAFKPLLSSRSLKCLVKNIPEST 271
Fly 229 E 229
|
Mouse 272 E 272
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR15069 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.