DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMG1 and Psmg1

DIOPT Version :9

Sequence 1:NP_649590.1 Gene:PSMG1 / 40719 FlyBaseID:FBgn0037378 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_062410.1 Gene:Psmg1 / 56088 MGIID:1860263 Length:289 Species:Mus musculus


Alignment Length:66 Identity:18/66 - (27%)
Similarity:31/66 - (46%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LEAPNFIAGVAAGVASWRDQMELPVTSFVIYTDKLPLDATAAQPVIKVLKAAGVACSSSYIPPRK 228
            ||.||.:..::|.|.|:....::|...::.|||.:.||....:....:|.:..:.|....||...
Mouse   207 LEQPNIVHDLSAAVLSYCQVWKIPAVLYLCYTDVMKLDRVTVEAFKPLLSSRSLKCLVKNIPEST 271

  Fly   229 E 229
            |
Mouse   272 E 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMG1NP_649590.1 None
Psmg1NP_062410.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
PAC1 2..288 CDD:292712 18/66 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15069
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.