DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMG1 and Psmg1

DIOPT Version :10

Sequence 1:NP_649590.1 Gene:PSMG1 / 40719 FlyBaseID:FBgn0037378 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_062410.1 Gene:Psmg1 / 56088 MGIID:1860263 Length:289 Species:Mus musculus


Alignment Length:66 Identity:18/66 - (27%)
Similarity:31/66 - (46%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LEAPNFIAGVAAGVASWRDQMELPVTSFVIYTDKLPLDATAAQPVIKVLKAAGVACSSSYIPPRK 228
            ||.||.:..::|.|.|:....::|...::.|||.:.||....:....:|.:..:.|....||...
Mouse   207 LEQPNIVHDLSAAVLSYCQVWKIPAVLYLCYTDVMKLDRVTVEAFKPLLSSRSLKCLVKNIPEST 271

  Fly   229 E 229
            |
Mouse   272 E 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMG1NP_649590.1 None
Psmg1NP_062410.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
PAC1 2..289 CDD:465018 18/66 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.