DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMG1 and psmg1

DIOPT Version :9

Sequence 1:NP_649590.1 Gene:PSMG1 / 40719 FlyBaseID:FBgn0037378 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001002714.1 Gene:psmg1 / 436987 ZFINID:ZDB-GENE-040718-469 Length:277 Species:Danio rerio


Alignment Length:260 Identity:52/260 - (20%)
Similarity:86/260 - (33%) Gaps:82/260 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FGELNIPSSRAFWDDCDED-------------ELENLKPVEKLQLKFDDDCDGEAAPVESEMLVV 57
            |||:....|||..:|..||             |:|..:.||...|....|     .|::...|::
Zfish     5 FGEVLSVYSRAVEEDEYEDMTNENEEDEQIRREIEEKRSVEVCWLLGSQD-----GPLQCSDLII 64

  Fly    58 IEGVNVTHFASSLLEKDAKRVCAIPANNSTLHWSHSSKQLLAIINEDLTSSGEVAELLLP----- 117
            ..|.|.:.|..:.|             .||:.|  ::...|:..||  .|.|.....::|     
Zfish    65 GAGPNASGFIRAYL-------------LSTVGW--TAVAWLSFWNE--RSRGSERPTVVPGPGEP 112

  Fly   118 --YVKLAKKVITLTLKPKVEFKSEDIQLYRDHIAVVRGIGANQKDIT------------------ 162
              .:...:...|:.:.....|.:|| ||::....|...:.....::|                  
Zfish   113 SCVLYRLESCPTVLICQCQGFVAED-QLFQFTEKVFSCVQTRDLNVTILSDCSSADYKTSDYLSG 176

  Fly   163 ---------------------ELEAPNFIAGVAAGVASWRDQMELPVTSFVIYTDKLPLDATAAQ 206
                                 .||.||..:|:||.|.|.....::....:..|:|.|..|:.:.|
Zfish   177 SSTPFLRCLKTSTYTHTVTCPPLEQPNICSGLAAAVLSHCQVHQISAVLYQCYSDVLHPDSASMQ 241

  Fly   207  206
            Zfish   242  241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMG1NP_649590.1 None
psmg1NP_001002714.1 PAC1 1..276 CDD:292712 52/260 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1232038at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15069
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.