DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMG1 and psmg1

DIOPT Version :9

Sequence 1:NP_649590.1 Gene:PSMG1 / 40719 FlyBaseID:FBgn0037378 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001096329.1 Gene:psmg1 / 100124915 XenbaseID:XB-GENE-494236 Length:287 Species:Xenopus tropicalis


Alignment Length:276 Identity:60/276 - (21%)
Similarity:111/276 - (40%) Gaps:69/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FGELNIPSSRAFWDDCD----EDELENLKPVEKLQLKFD-------------DDCDGEAAPVESE 53
            |||:....|||..:|.:    |:|.|:.:.:.:|:.|.:             :.......|..:.
 Frog     5 FGEVQSVFSRAVDEDDEEEEGEEEEEDREIIAELERKREVHVTWNPEVTAAIESSPNRRLPCSNV 69

  Fly    54 MLVVIEGVNVTHFASS-LLEKDAKRVC------------------AIPANNS-TLHWSHSSKQLL 98
            :|.|  |.|.|.|.|| :|...:..||                  ::||.:| |.:.|.:...:|
 Frog    70 ILSV--GDNATGFVSSYILSSGSWEVCGSITLWNERCRDCNPRKDSLPAPSSCTFYRSITDPTVL 132

  Fly    99 -----AIINED--------LTSSGEVAELLLPYVKLAKKVITLTLKPKVEFKSEDIQLYRDHIAV 150
                 :.|.||        :..|.|.:.|         .|..|:..|..|:|:.: ..|...:..
 Frog   133 LCQCNSYIAEDQLFQWCEKVFGSLEKSSL---------NVTVLSTCPVSEYKTPE-STYSLPVPF 187

  Fly   151 VRGIGANQ--KDI--TELEAPNFIAGVAAGVASWRDQMELPVTSFVIYTDKLPLDA---TAAQPV 208
            ::.:..::  :::  ..||.||...|:.|.|.::....::|...:..|||...||:   .|.:|:
 Frog   188 LKALRTSEYREEVPCPLLEQPNIADGLPAAVLTYCQVWQIPAVFYRCYTDLSKLDSITIDAFRPL 252

  Fly   209 IKVLKAAGVACSSSYI 224
            :...:.:.:|..|:.|
 Frog   253 LSCQRMSRLAADSAKI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMG1NP_649590.1 None
psmg1NP_001096329.1 PAC1 1..286 CDD:318342 60/276 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1232038at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15069
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.