DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn5 and EMB2107

DIOPT Version :9

Sequence 1:NP_649588.1 Gene:Rpn5 / 40717 FlyBaseID:FBgn0028690 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001119202.1 Gene:EMB2107 / 830850 AraportID:AT5G09900 Length:462 Species:Arabidopsis thaliana


Alignment Length:387 Identity:132/387 - (34%)
Similarity:200/387 - (51%) Gaps:81/387 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IEMMLQLEKQTRLGADMVSCSRVLVAICQICFDASNWNALNEYVSLLVRRRSQLKQAVVKMIQEC 108
            |:.:|..|||.||..::....:....|.|:||||.:|..|||.:..|.::|.||||||..|:|:.
plant    11 IDRLLNEEKQMRLAENVAGTRKAATEILQLCFDAKDWKLLNEQILNLSKKRGQLKQAVQSMVQQA 75

  Fly   109 VTYVDKTPDKETKLKLIDTLRSVTEGKIYVEIERARLTKILADIKEADGDVAGAATVMEELQVET 173
            :.|:|:|||.||:::||.||.:|:.||||||||||||||.||.|||..|.:|.||.:|:|:.|||
plant    76 MQYIDQTPDIETRIELIKTLNNVSAGKIYVEIERARLTKKLAKIKEEQGQIAEAADLMQEVAVET 140

  Fly   174 YGSMDKREKVELILEQMRLCLLKEDYVSTQIIAKKISIKFFDDPAQHD----------------- 221
            :|:|.|.||:..||||:||||.::|:|..||:::||:.:.||...:.|                 
plant   141 FGAMAKTEKIAFILEQVRLCLDRQDFVRAQILSRKINPRVFDADTKKDKKKPKEGDNMVEEAPAD 205

  Fly   222 ----LKLK--FYYLMIQ-LNRDTSFLNTSRHYQAIAEPPRKKTGLTPVDSAASTDEQKKKDDDKK 279
                |:||  :|.|||: .:.:..::...|.|:||.:.|                          
plant   206 IPTLLELKRIYYELMIRYYSHNNEYIEICRSYKAIYDIP-------------------------- 244

  Fly   280 KKEEDDKDKKPEVATEAEVEIELTEEQKKELTEKLVCAVLYCVLAPFDNEQSDMMAHLSKNKKLE 344
                               .::.|.||...:..| :|  .:.||||.|..||.::....::|.|.
plant   245 -------------------SVKETPEQWIPVLRK-IC--WFLVLAPHDPMQSSLLNATLEDKNLS 287

  Fly   345 EVPAYKEILRLFMSKELIN----FDTFNADFGLVLAENEMFKDSTKHGKKCITELKDRLIEH 402
            |:|.:|.:|:..::.|:|.    ::.:..:|     |.|........|.|...:||.|:|||
plant   288 EIPDFKMLLKQVVTMEVIQWTSLWNKYKDEF-----EKEKSMIGGSLGDKAGEDLKLRIIEH 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn5NP_649588.1 RPN5 13..496 CDD:227403 132/387 (34%)
EMB2107NP_001119202.1 RPN5 7..>344 CDD:227403 130/385 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 183 1.000 Domainoid score I1010
eggNOG 1 0.900 - - E1_COG5071
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2109
Inparanoid 1 1.050 274 1.000 Inparanoid score I899
OMA 1 1.010 - - QHG54023
OrthoDB 1 1.010 - - D937686at2759
OrthoFinder 1 1.000 - - FOG0003700
OrthoInspector 1 1.000 - - otm3369
orthoMCL 1 0.900 - - OOG6_102014
Panther 1 1.100 - - LDO PTHR10855
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2567
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.