DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jagn and AT5G51510

DIOPT Version :9

Sequence 1:NP_649585.1 Gene:jagn / 40714 FlyBaseID:FBgn0037374 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_568761.1 Gene:AT5G51510 / 835225 AraportID:AT5G51510 Length:170 Species:Arabidopsis thaliana


Alignment Length:123 Identity:33/123 - (26%)
Similarity:53/123 - (43%) Gaps:18/123 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TRGGPMVAGTDGNDFEFRQRVAGTYQISLLNKSRLKYCIFFHALLFFVML--AKLTSDILDHLDI 65
            |.|.|  :||||:||.:|..|...|......|:||:..||..|.::.:.|  |.||:...|..:.
plant     7 TAGRP--SGTDGSDFSYRMVVDSRYTKVTKEKARLRPLIFVQAAIYVIGLSCAFLTTTKKDEKNT 69

  Fly    66 FVLEIEELEVPPPLWWEYVWAASLLTSFLGLSAARGNKVREMQKYMVAILLFAILPLF 123
            ..:...              .|.|:.|.:|....|.::|..::.|..|..:..:|.:|
plant    70 LAIAAA--------------VAGLVCSLIGELGCRRSRVNLLRLYTAASTIVMVLSVF 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jagnNP_649585.1 Jagunal 1..188 CDD:284495 33/123 (27%)
AT5G51510NP_568761.1 Jagunal 10..>113 CDD:399819 30/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1452436at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR20955
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.