DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jagn and Jagn1

DIOPT Version :9

Sequence 1:NP_649585.1 Gene:jagn / 40714 FlyBaseID:FBgn0037374 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_080641.1 Gene:Jagn1 / 67767 MGIID:1915017 Length:183 Species:Mus musculus


Alignment Length:195 Identity:59/195 - (30%)
Similarity:101/195 - (51%) Gaps:14/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATRGGPMVAGTDGNDFEFRQRVAGTYQISLLNKSRLKYCIFFHALLFFVMLAKLTSDILDHLDI 65
            ||:|.||..|||||:||:.|:|||..||:|:..|..:|..|:.|.:::.:::||::   :.||.:
Mouse     1 MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMS---VGHLRL 62

  Fly    66 FVLEIEELEVPPPLWWEYVWAASLLTSFLGLSAARGNKVREMQKYMVAILLFAILPLFYCFAYYF 130
                :...:|..|..|||.:..|::.|.|||.:...|.:..:...|:::.||:|.||.|.....|
Mouse    63 ----LSHDQVAMPYQWEYPYLLSIVPSVLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMF 123

  Fly   131 SDVWEFATLDKSVELDETDIFVWRGYPYGVFWYAFCFVGFQVHGFTLYFAYNLVKAWKARTATRK 195
            ....:.....|:..      |:: |:......|....:..|||.:.||::..|:.:|...|..:|
Mouse   124 PAAQQLYRHGKAYR------FLF-GFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKK 181

  Fly   196  195
            Mouse   182  181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jagnNP_649585.1 Jagunal 1..188 CDD:284495 56/186 (30%)
Jagn1NP_080641.1 Jagunal 1..177 CDD:399819 57/189 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847371
Domainoid 1 1.000 90 1.000 Domainoid score I7799
eggNOG 1 0.900 - - E1_KOG4054
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5084
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48965
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006112
OrthoInspector 1 1.000 - - oto94755
orthoMCL 1 0.900 - - OOG6_107788
Panther 1 1.100 - - LDO PTHR20955
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2589
SonicParanoid 1 1.000 - - X4407
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.