DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jagn and K05C4.2

DIOPT Version :9

Sequence 1:NP_649585.1 Gene:jagn / 40714 FlyBaseID:FBgn0037374 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001379212.1 Gene:K05C4.2 / 173335 WormBaseID:WBGene00010579 Length:189 Species:Caenorhabditis elegans


Alignment Length:192 Identity:63/192 - (32%)
Similarity:96/192 - (50%) Gaps:14/192 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATRGGPMVAGTDGNDFEFRQRVAGTYQISLLNKSRLKYCIFFHALLFFVMLAKLTSDIL----D 61
            |::| |...|||||.||:.|||||..||.|...||.||:....|.|:...|..|:.|::|    .
 Worm     1 MSSR-GVRAAGTDGTDFQNRQRVAQHYQESAQYKSILKWFFVPHFLILVFMWLKVGSELLRTNFG 64

  Fly    62 HLDIFVLEIEELEVPPPLWWEYVWAASLLTSFLGLSAARGNKVREMQKYMVAILLFAILPLFYCF 126
            ..:.|   .:.|::|....|||||..|.:...|.:.:.:.||::.:.....|..:..|.|.....
 Worm    65 WKNAF---FDRLDMPSAYPWEYVWCFSFIPIVLAIYSFQRNKLKILHYAYYAEFVVGIFPCMIGL 126

  Fly   127 AYYFSDVWEFATLDKSVELDETDIFVWRG-YPYGVFWYAFCFVGFQVHGFTLYFAYNLVKAW 187
            .....::.|:|   :.:|...|..|  :| :|..:.||.|..|..|:|||::||.::|..||
 Worm   127 GGQLPELMEYA---QDMEGSNTPTF--KGIFPMVIIWYIFFAVALQIHGFSMYFMHHLAAAW 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jagnNP_649585.1 Jagunal 1..188 CDD:284495 63/192 (33%)
K05C4.2NP_001379212.1 Jagunal 1..185 CDD:399819 63/192 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165191
Domainoid 1 1.000 93 1.000 Domainoid score I4792
eggNOG 1 0.900 - - E1_KOG4054
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I3658
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48965
OrthoDB 1 1.010 - - D1452436at2759
OrthoFinder 1 1.000 - - FOG0006112
OrthoInspector 1 1.000 - - oto18630
orthoMCL 1 0.900 - - OOG6_107788
Panther 1 1.100 - - LDO PTHR20955
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2589
SonicParanoid 1 1.000 - - X4407
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.