DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2082 and NDL2

DIOPT Version :9

Sequence 1:NP_001163513.1 Gene:CG2082 / 40713 FlyBaseID:FBgn0027608 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_568251.1 Gene:NDL2 / 831051 AraportID:AT5G11790 Length:344 Species:Arabidopsis thaliana


Alignment Length:304 Identity:77/304 - (25%)
Similarity:136/304 - (44%) Gaps:42/304 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GDLTVIVQGDLSQQEKRAVFITVHDLGCNHN-SFQEFVSSP-CMTEIKERSCFIHVDVPGHADNA 96
            |.:.|.|.||   .:|.|: ||..|:..|:. .||..:..| ..:.:....|..|:...||...|
plant    29 GPVCVAVCGD---PDKPAL-ITYPDIALNYMFCFQGLLFCPEASSLLLHNFCIYHISPLGHELGA 89

  Fly    97 EALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGS 161
            ..::...|..|...|.:.:|.||:|..:..|:.:|..|||.:|..|.:.:..|||||||::....
plant    90 PMISVDAPLLSADDLADQIVEVLNYFGLGAVMCMGVTAGAYILTLFAMKYRQRVLGLILVSPLCQ 154

  Fly   162 AASVVQSFKNKFISWKSDEVAQSAESFLMYH-KFGHVMEQIV-----------GENPDKEKIVAE 214
            |.|..:...||.:|           :.|.|: ..|.|.|.::           |..|:.: ||.|
plant   155 APSWSEWLCNKVMS-----------NLLYYYGTCGVVKEMLLKRYFSKEVRGNGHVPESD-IVQE 207

  Fly   215 YQKRLHRSLNSKNIGLYVKAFMNRKDLT--LKGCKVDVILITGMLSPYASMVEKLHRDVEKERVT 277
            . :||.....|.|:..:::|...|.||:  |:..:...::..|..|.|.|....:...:::....
plant   208 C-RRLLSERQSTNVWRFLEAINGRVDLSEGLRKLQCRTLIFIGENSAYHSEAVHMTTKLDRRYGA 271

  Fly   278 ILKIERAGDVLADAPGKVAQSILL----FCKGQGLL--TSVVMP 315
            :::::.:|.::::   :..|::::    |..|.||.  |..|.|
plant   272 LVEVQGSGSLVSE---EQPQAMIIPMEYFLMGYGLYRPTQSVSP 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2082NP_001163513.1 Abhydrolase 26..310 CDD:419691 74/297 (25%)
NDL2NP_568251.1 Abhydrolase 21..305 CDD:419691 74/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2931
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D854690at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1173
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11034
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.